PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00122110001
Common NameGSBRNA2T00122110001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 605aa    MW: 66859.7 Da    PI: 8.5415
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00122110001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-LSD139.87.7e-131034125
              zf-LSD1  1 CggCrtlLsYPrGApsVRCalCdtV 25
                         C+gCrt+L+ P GA+s+RCalC+++
  GSBRNA2T00122110001 10 CSGCRTPLQLPSGARSIRCALCQAI 34
                         ***********************97 PP

2DUF260108.45.7e-34421512192
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++++sl++eA +r++dPv G++g +++ +++l+  
  GSBRNA2T00122110001 421 ACASCKHQRKKCNNECILSPYFPARKTKEFQAVHKVFGVSNVQKMVRTVREEDRPKLTDSLTWEALWRQKDPVLGSYGEYMRQSEELKLY 510
                          7*******************************************************************************9999999887 PP

               DUF260  91 ka 92 
                          k+
  GSBRNA2T00122110001 511 KS 512
                          75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR010532.9E-17737IPR005735Zinc finger, LSD1-type
PfamPF069436.4E-111034IPR005735Zinc finger, LSD1-type
Gene3DG3DSA:3.40.50.14601.5E-8573313IPR029030Caspase-like domain
PfamPF006561.7E-5975354No hitNo description
Gene3DG3DSA:3.40.50.14601.5E-85348368IPR029030Caspase-like domain
PROSITE profilePS5089123.801420520IPR004883Lateral organ boundaries, LOB
PfamPF031958.9E-32421512IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0004197Molecular Functioncysteine-type endopeptidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MYPPPMLVNC SGCRTPLQLP SGARSIRCAL CQAITHIADP RSAPPPPQSH SSAVAPPPSH  60
VPAPLGQLPH PHGRKRAVIC GISYRFSRHE LKGCINDAKC MRHLLINKFK FAPDSILMLT  120
EEETDPYRIP NKQNMRMALY WLVQGCTAGD SLVFHYSGHG SRQRNYNGDE VDGYDETLCP  180
LDFETQGMIV DDEINATIVR PLPHGVKLHS IIDACHSGTV LDLPFLCRMD RSGQYVWEDH  240
RPRSGLWKGT AGGEAISISG CDDDQTSADT SALSKITSTG AMTFCFIQAI ERSPQGTTYG  300
NILNSMRTTI RNTGSGGGVS VGGGGGGVVS SVLTMLLTGG SGMGGLRQEP QLTACEPFDV  360
YAKPFILYSK QNLDRDKCYY PCSFYRYLKL SSIMHKNMGD DMMQMNFNNS NISNNAPPHQ  420
ACASCKHQRK KCNNECILSP YFPARKTKEF QAVHKVFGVS NVQKMVRTVR EEDRPKLTDS  480
LTWEALWRQK DPVLGSYGEY MRQSEELKLY KSLIHNQSLV TWDNNNNQQR VFNNSNNNKN  540
GSAINSSGSG GFSVVNNNGV GVNREIINGG YTSRNLQGGW GNLKQDQRQQ CYAVINGFKH  600
HLPH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4f6o_A2e-464636024344Metacaspase-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.172020.0flower| leaf| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00122110001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009118546.10.0PREDICTED: metacaspase-1
RefseqXP_013716507.10.0PREDICTED: metacaspase-1
SwissprotQ7XJE60.0MCA1_ARATH; Metacaspase-1
TrEMBLA0A078F0340.0A0A078F034_BRANA; BnaA09g49990D protein
STRINGBra032430.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.12e-82LOB domain-containing protein 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]